Selected Sequence(s) Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (HMP) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) [Escherichia coli] -------------------------------------------------------------------------------- Origin Sequence Name SWISSPROT HBD_HUMAN Hemoglobin delta subunit (Hemoglobin delta chain) (Delta-globin) [Homo sapiens (Human)] *NOTE: Fewer than 20 sequences selected - No Statistics will be calculated. -------------------------------------------------------------------------------- [ Download Unformatted Results ] Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (HMP) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) [Escherichia coli] - And - Hemoglobin delta subunit (Hemoglobin delta chain) (Delta-globin) [Homo sapiens (Human)] -------------------------------------------------------------------------------- Click on the value in the last column of the table to go to the corresponding alignment.Sequence label (No. aa/nt) s-w HBD_HUMAN ( 146) 70 Sequence Matches: -------------------------------------------------------------------------------- Distribution Statistics: 146 residues in 1 sequences Smith-Waterman (PGopt) (3.39 May 2001) function [BL50 matrix (15:-5)], gap-penalty: -12/-2 Scan time: 0.010 -------------------------------------------------------------------------------- Alignments for Best Scores: Back to table >>HBD_HUMAN (146 aa) s-w opt: 70 Smith-Waterman score: 70; 23.611% identity (25.000% ungapped) in 72 aa overlap (61-130:68-137) 40 50 60 70 80 HMP_EC RMFTHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTS-FQ ..:..... .: : . .... : . .. HBD_HU TQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLH 40 50 60 70 80 90 90 100 110 120 130 140 HMP_EC IKPEQYNIVGEHLLATLDEMFSPGQEVLDAWGKAYG-VLANVFINREAEIYNENASKAGG . ::.. ..:. :. .: . : :.: :: :.:.: HBD_HU VDPENFRLLGNVLVCVLARNF--GKEFTPQMQAAYQKVVAGVANALAHKYH 100 110 120 130 140 150 160 170 180 190 200 HMP_EC WEGTRDFRIVAKTPRSALITSFELEPVDGGAVAEYRPGQYLGVWLKPEGFPHQEIRQYSL 396 residues in 1 query sequences 146 residues in 1 library sequences Tcomplib (2 proc)[33t08] start: Mon Dec 3 21:51:59 2007 done: Mon Dec 3 21:51:59 2007 Scan time: 0.010 Display time: 0.000