!!RICH_SEQUENCE 1.0 .. { name DQ160058 descrip Taraxacum officinale TO52-2 (To52-2) mRNA, partial cds. type DNA longname Taraxacum officinale sequence-ID DQ160058 checksum 4492 creation-date 09/23/2005 09:57:02 strand 1 comments LOCUS DQ160058 389 bp mRNA linear HTC 21-SEP-2005 DEFINITION Taraxacum officinale TO52-2 (To52-2) mRNA, partial cds. ACCESSION DQ160058 VERSION DQ160058.1 GI:75755890 KEYWORDS HTC. SOURCE Taraxacum officinale ORGANISM Taraxacum officinale Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Taraxacum. REFERENCE 1 (bases 1 to 389) AUTHORS Hulzink,R.J.M., van Dijk,P.J. and Biere,A. TITLE Isolation and characterization of candidate genes for pathogen and herbivory defense in common dandelion (Taraxacum officinale) upon salicylic acid or methyl jasmonate treatment JOURNAL Unpublished REFERENCE 2 (bases 1 to 389) AUTHORS Hulzink,R.J.M., van Dijk,P.J. and Biere,A. TITLE Direct Submission JOURNAL Submitted (09-AUG-2005) Centre for Terrestrial Ecology, Netherlands Institute for Ecology, Boterhoeksestraat 48, Heteren 6666 ZG, The Netherlands FEATURES Location/Qualifiers source 1. .389 /organism="Taraxacum officinale" /mol_type="mRNA" /db_xref="taxon:50225" /dev_stage="seedling; fifth leaf stage" /note="salicylic acid or methyl jasmonate responsive genotype: triploid apomictic clone 68" gene <1. .389 /locus_tag="To52-2" CDS <1. .175 /locus_tag="To52-2" /note="similar to aspartyl-tRNA synthetase or aspartate--tRNA ligase; contains premature internal stop codon" /codon_start=2 /product="TO52-2" /protein_id="ABA27003.1" /db_xref="GI:75755891" /translation="NTEIRKNSKENLFWKSMEPSFIFYTGTLLLSGLSTQCHVVTTSC IATHLMFSLEGRR" feature 1 389 -1 square solid source source 1. .389 /organism="Taraxacum officinale" /mol_type="mRNA" /db_xref="taxon:50225" /dev_stage="seedling; fifth leaf stage" /note="salicylic acid or methyl jasmonate responsive genotype: triploid apomictic clone 68" feature 1 389 6 square solid gene gene <1. .389 /locus_tag="To52-2" feature 1 175 4 square solid CDS CDS <1. .175 /locus_tag="To52-2" /note="similar to aspartyl-tRNA synthetase or aspartate--tRNA ligase; contains premature internal stop codon" /codon_start=2 /product="TO52-2" /protein_id="ABA27003.1" /db_xref="GI:75755891" /translation="NTEIRKNSKENLFWKSMEPSFIFYTGTLLLSGLSTQCHVVTTSC IATHLMFSLEGRR" sequence taatacagagatccgaaagaactctaaggaaaacttgttttggaaaagtatggaaccgag ttttatattctacaccggtaccctcttgctgtccggcctttctacacaatgccatgtcgt gacaacgagttgtatagcaactcatttgatgttttcattagaggggaggagataatttca ggagctcaacgtgtgcacatacctgaacttttggaggcacgtgcaactgcatgtgggatt gatctcaaaaccatatcatcatacattgattccttcaggtatggtgcgcctccacatggc gggattggagttggattggaacgtgttgtgatgcttttttgtggccttgataacattcgt aaagtctcacttttcccacgtgaccttcg }